Protein Info for AO353_24255 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 12 to 42 (31 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 136 to 164 (29 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details PF01925: TauE" amino acids 12 to 245 (234 residues), 125.6 bits, see alignment E=1.3e-40

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 83% identity to pfs:PFLU5335)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0T4 at UniProt or InterPro

Protein Sequence (248 amino acids)

>AO353_24255 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MMGHEWLTGVGLVFLGIITGFVGTNTGGSVFLTVPVMIWLGIPPQSSIATARLASVGTMV
AGLRHFHNQGKVDYALAVPAAVLGLAGALGGASLLLRIDPALLHKVIGGLTLLLVALSLI
KKPRNGETPPSAIRRLFGYILFIPVGMIGGLLGGQAKLSTYLFIIFFRKTISESVGTRKV
GGLVLSVGSLIIFGVSGIINWQYGWCLVIGTLLGANAGAKFALKKGDQWMESVFNIVVIA
LALRMLFW