Protein Info for AO353_24070 in Pseudomonas fluorescens FW300-N2E3

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00106: adh_short" amino acids 8 to 199 (192 residues), 145.9 bits, see alignment E=1.6e-46 PF08659: KR" amino acids 8 to 184 (177 residues), 47 bits, see alignment E=4.2e-16 PF13561: adh_short_C2" amino acids 13 to 206 (194 residues), 94.9 bits, see alignment E=9e-31

Best Hits

KEGG orthology group: K07124, (no description) (inferred from 87% identity to pba:PSEBR_a3066)

Predicted SEED Role

"Ketoacyl reductase hetN (EC 1.3.1.-)" (EC 1.3.1.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VTT8 at UniProt or InterPro

Protein Sequence (261 amino acids)

>AO353_24070 short-chain dehydrogenase (Pseudomonas fluorescens FW300-N2E3)
MKSNENSWVLITGASSGFGEEFARQYAAQGKSLVLVARRLSKLEALSAQLRERFGVDVIV
EQVDLSSIPAIIELHERLSERNIVIDVLINNAGHGLQGPFLDQPLDESLTMIDLDIASLT
GLTRLFAADMRARKRGHILMVASLLSFQGVKNFAVYSAAKAYVLRFSDALHRELKKDGVV
VTALCPGMSDTGFAESAKQRITPALKMVMMQPQPVVRAGIRALQAGRMSVVPGFGNKAIT
VLTWATPRRFHQSLMAQVMGV