Protein Info for AO353_24055 in Pseudomonas fluorescens FW300-N2E3

Annotation: ligand-gated channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 756 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details PF07715: Plug" amino acids 108 to 200 (93 residues), 43.4 bits, see alignment E=4.4e-15 TIGR01783: TonB-dependent siderophore receptor" amino acids 109 to 756 (648 residues), 371.7 bits, see alignment E=4.2e-115 PF00593: TonB_dep_Rec" amino acids 312 to 720 (409 residues), 140.9 bits, see alignment E=1.2e-44

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 66% identity to asa:ASA_4368)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X0A2 at UniProt or InterPro

Protein Sequence (756 amino acids)

>AO353_24055 ligand-gated channel protein (Pseudomonas fluorescens FW300-N2E3)
MSEHGRPHSANPDSSQATQRAFSFTLNRTFSAVHMALLLGLTGGAMAVSAAPASEPQSPT
GTGEGSLVLSETTVEGTMGASADLPPAYAGGQVATGSRVGLLGTKDFMETPFSAISYTDD
FVRNHQAKDIGSVIGATDPSVNVPSKRAILETFFIRGFNTSANDITYNGLIGMAPNLRGA
TELAERIEVLKGPSALLNGMPPDGSVAGSINMVPKRAGDEPLTRLTTSFESNGLYGAHAD
VGRRFGEQNQFGIRYNGAYRDGDTAVDDQKQNMQLNALGLDWRAERIRLSLDAYKHREHL
EGTNYFGISSINPTVTNVPRAKKGDYALAPDWAYTTNDTETFLLRGEVDLNDSLTAFAAY
GQREGGRNSLMTRDTLINNAGDISVLAYRSDGQGIQKSGEAGLKGRFDTGPVGHQWSLAA
TQYKSEMSFKDKQIANYVTTNYYNLDFGKTPPLDNFGAVTSRTEAKLGSVAFLDTLSFLD
DRIQWTLGVRRQSVESSNLTPARVKTSHYDESRVSPATALLVKVTDDVSVYANYIEGLSQ
GGTAPTTAANPGEILSPIQTKQYEVGAKLDLGTFATTLAVFQIEKPSTFTDPVTRIFGVN
GEQRNRGVEWSFFGEAQPDLRLMGGVSYTQAVLTKAQVAANEGNQVTGVPKIIGKLGVEY
DLERVPGLTLTAGTNYVGSRYVTDDHRMELPSYTVFDVGGRYTTKVMSKPVTLRANVENL
ANRAYWLGSYSGGDGSGLSGGLGAPRTLQLSASVDF