Protein Info for AO353_24040 in Pseudomonas fluorescens FW300-N2E3

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 224 to 251 (28 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details PF01032: FecCD" amino acids 31 to 311 (281 residues), 139 bits, see alignment E=9e-45

Best Hits

Swiss-Prot: 50% identical to FATC_VIBA7: Ferric-anguibactin transport system permease protein FatC (fatC) from Vibrio anguillarum (strain ATCC 68554 / 775)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 84% identity to pen:PSEEN2495)

Predicted SEED Role

"Iron compound ABC uptake transporter permease protein PiuC" in subsystem Heme, hemin uptake and utilization systems in GramPositives

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VYL7 at UniProt or InterPro

Protein Sequence (316 amino acids)

>AO353_24040 iron ABC transporter permease (Pseudomonas fluorescens FW300-N2E3)
MRRVATRYGLWLLVLVLAIGFLLLGAGLDFDYVIPKRLTRLAAMCIAGVCIAYSSVIFQT
IAGNRILTPAIMGYEAIYLLFQALLILLLGTQSLVLLGRDGNVLLSVLLMLGYSWLIHRW
LFRDGSNNVYLLLLLGLVLSMVMGTFTQFIQLKISPGEFSIFQGFNYASFNKAQPGQVIY
SGVLVAAVCCIAQRTLPVLDVLSLGRDQAISLGVDYPRSVRLQLALIAILVAISTSLVGP
TAFMGVFVANISYALARTARHRVTLPMSCAIAIGIFIVAQYLVEQIFNYNTSVSILINLV
CGVYFLALMIRTRGTP