Protein Info for AO353_24035 in Pseudomonas fluorescens FW300-N2E3

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details PF01032: FecCD" amino acids 2 to 293 (292 residues), 211.9 bits, see alignment E=1.2e-66 PF00950: ABC-3" amino acids 87 to 292 (206 residues), 24.8 bits, see alignment E=1.5e-09

Best Hits

Swiss-Prot: 68% identical to FATD_VIBA7: Ferric-anguibactin transport system permease protein FatD (fatD) from Vibrio anguillarum (strain ATCC 68554 / 775)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 82% identity to axy:AXYL_05459)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0S9 at UniProt or InterPro

Protein Sequence (296 amino acids)

>AO353_24035 iron ABC transporter permease (Pseudomonas fluorescens FW300-N2E3)
MVGVKQVSWTALFTFSEDAWLTLTASRLPRLAALILTGVGLAVCGVILQQIVRNRFVEPA
TSGGLDAAKLGILISLTVAPAAGTVGRMLFALVFCFAASLIYIAIIRRIKFKNTVMIPVI
GLMYGSVLSAVAEFYAYRHNILQSMQGWMLGDFSKIVQGNYEIIYLILPIVVLTYLYAHR
FTVLGMGEGMASSLGLNYAANAALGLMLVAVTVSATVITVGAIPFVGLVIPNLVALHYGE
NLERTLPIVALCGASLLLACDILGRLLIYPFEVPIGLTAGSVGGLIFLVLLIRKYT