Protein Info for AO353_24020 in Pseudomonas fluorescens FW300-N2E3

Annotation: RNA polymerase subunit sigma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 11 to 159 (149 residues), 63.6 bits, see alignment E=8.6e-22 PF07638: Sigma70_ECF" amino acids 13 to 155 (143 residues), 22.4 bits, see alignment E=1.5e-08 PF04542: Sigma70_r2" amino acids 15 to 79 (65 residues), 36.7 bits, see alignment E=4.6e-13 PF08281: Sigma70_r4_2" amino acids 121 to 163 (43 residues), 39.7 bits, see alignment E=4.6e-14

Best Hits

Swiss-Prot: 37% identical to FECI_ECOLI: Probable RNA polymerase sigma factor FecI (fecI) from Escherichia coli (strain K12)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 64% identity to pen:PSEEN2499)

MetaCyc: 37% identical to RNA polymerase sigma factor FecI (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WH14 at UniProt or InterPro

Protein Sequence (172 amino acids)

>AO353_24020 RNA polymerase subunit sigma (Pseudomonas fluorescens FW300-N2E3)
VDNGAFASQEQFEKLYVDHYRWLCNLLRRKLGNSVDAADLAHDVYLNLIRKGRVPSTENS
RRHLTQIAKGMVIDLYRRRHLEASHLEGLMQQAEPQVPSEEVRALASEALSQIDVALHNK
PLKAREALLMCKLHGMGHRDIAAELKVSVSSVEKYIAAGLRACHPFASGAGL