Protein Info for AO353_24010 in Pseudomonas fluorescens FW300-N2E3

Annotation: Rhizobactin siderophore biosynthesis protein RhbE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 PF13434: Lys_Orn_oxgnase" amino acids 6 to 345 (340 residues), 370.7 bits, see alignment E=3.6e-115 TIGR04439: putative histamine N-monooxygenase" amino acids 8 to 436 (429 residues), 805.7 bits, see alignment E=4.5e-247

Best Hits

Swiss-Prot: 66% identical to RHBE_RHIME: Rhizobactin siderophore biosynthesis protein RhbE (rhbE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03897, lysine N6-hydroxylase [EC: 1.14.13.59] (inferred from 84% identity to pen:PSEEN2502)

MetaCyc: 84% identical to histamine N-monooxygenase (Pseudomonas entomophila L48)
1.14.13.M66 [EC: 1.14.13.M66]

Predicted SEED Role

"Siderophore biosynthesis protein, monooxygenase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.59 or 1.14.13.M66

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WPS0 at UniProt or InterPro

Protein Sequence (439 amino acids)

>AO353_24010 Rhizobactin siderophore biosynthesis protein RhbE (Pseudomonas fluorescens FW300-N2E3)
MTDIPTVDIAGVGIGPFNLGLAALLSRHTGVTGIFLDRKAEFRWHEGLLLPGTTLQVPFL
ADLVTMADPTHPLSYLNYLHQHDRLYQFYYYENFQVPRREYDHYCRWASQQLPVCHFGED
ICDVSYDASVDRFLIESQSVSGFKRRYYSRDLAIGVGTVPLLPKWAQLKSTPPVMHSAEF
GKRQEQLAQCRRVTVIGSGQSAAECVLALFNELTPERIAAGASIRWITRSPGFHPMEYSK
LGQECFTPSYMEYFHSIPRERRRDIVAGQGLLYKGISFSTIAQIYDLIYERSIGGADTGL
TLLSNCEVETVEDVDGTLRIVYRHRELDQTGTLEADAIVAATGYGHAWPQWFERLKGVVL
ETDEFGDCIVQEDFTARRCDEGTGRIFVQNAEIFQHGVGSPDLGVAAIRNATIANRLLGR
THYRLPKRSSFQRYGMHEA