Protein Info for AO353_24000 in Pseudomonas fluorescens FW300-N2E3

Annotation: isochorismate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00543: isochorismate synthase
  • amino acids 109 to 387 (279 residues), 325.5 bits, E=2.2e-101
• PF00425: Chorismate_bind
  • amino acids 124 to 379 (256 residues), 252.2 bits, E=3.1e-79

Best Hits

Swiss-Prot: 43% identical to AMOA_AERHY: Putative isochorismate synthase (amoA) from Aeromonas hydrophila

KEGG orthology group: K02361, isochorismate synthase [EC: 5.4.4.2] (inferred from 76% identity to pen:PSEEN2504)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of chorismate metabolism (43/59 steps found)
• salicylate biosynthesis I (2/2 steps found)
• 2,3-dihydroxybenzoate biosynthesis (2/3 steps found)
• salicylate biosynthesis II (2/3 steps found)
• enterobactin biosynthesis (5/11 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (2/7 steps found)
• superpathway of menaquinol-8 biosynthesis I (4/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (3/9 steps found)
• superpathway of menaquinol-10 biosynthesis (3/10 steps found)
• superpathway of menaquinol-11 biosynthesis (3/10 steps found)
• superpathway of menaquinol-12 biosynthesis (3/10 steps found)
• superpathway of menaquinol-13 biosynthesis (3/10 steps found)
• superpathway of menaquinol-6 biosynthesis (3/10 steps found)
• superpathway of menaquinol-7 biosynthesis (3/10 steps found)
• superpathway of menaquinol-9 biosynthesis (3/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (2/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (2/9 steps found)
• vibriobactin biosynthesis (2/9 steps found)
• bacillibactin biosynthesis (4/12 steps found)
• superpathway of phylloquinol biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of siderophore group nonribosomal peptides
• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.4.2

Sequence Analysis Tools

See A0A0N9X096 at UniProt or InterPro

Protein Sequence (391 amino acids)

>AO353_24000 isochorismate synthase (Pseudomonas fluorescens FW300-N2E3)
MRSGTLRANDTDEVQAIDEKESFSFTSGDRELTVAGMLQRIETPAIGGENANSLFQKTVM
QALDRARKAGQSNPIIVGAIPFDPAEASCLYIPEHAEWRTRSATVQTDVAALPELIEQKN
IPDEQGFKRAVEHAIVNFRHSDVRKAVLSVQRELVFAQDVDVGAMQNNLRAQNQSGYHFR
VPMPDGATLIGVSPELLVHKDGLNFVSNPLAGSAKRMSDPQADRRNADWLSASEKDHYEH
RLVTEDIATQLGELCTQLDVPQRPSLISTPALWHLSTRIEGTLADPTVSALQLACRLHPT
PAVCGFPTERARRLIRFVEPFERGLFTGMVGWCDAQGNGEWVVTIRCGTVKRNRVRLFAG
AGIVEASSPDSEWTEVQTKLGTMLRACGLAH