Protein Info for AO353_24000 in Pseudomonas fluorescens FW300-N2E3

Annotation: isochorismate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 TIGR00543: isochorismate synthase" amino acids 109 to 387 (279 residues), 325.5 bits, see alignment E=2.2e-101 PF00425: Chorismate_bind" amino acids 124 to 379 (256 residues), 250.7 bits, see alignment E=9.2e-79

Best Hits

Swiss-Prot: 43% identical to AMOA_AERHY: Putative isochorismate synthase (amoA) from Aeromonas hydrophila

KEGG orthology group: K02361, isochorismate synthase [EC: 5.4.4.2] (inferred from 76% identity to pen:PSEEN2504)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X096 at UniProt or InterPro

Protein Sequence (391 amino acids)

>AO353_24000 isochorismate synthase (Pseudomonas fluorescens FW300-N2E3)
MRSGTLRANDTDEVQAIDEKESFSFTSGDRELTVAGMLQRIETPAIGGENANSLFQKTVM
QALDRARKAGQSNPIIVGAIPFDPAEASCLYIPEHAEWRTRSATVQTDVAALPELIEQKN
IPDEQGFKRAVEHAIVNFRHSDVRKAVLSVQRELVFAQDVDVGAMQNNLRAQNQSGYHFR
VPMPDGATLIGVSPELLVHKDGLNFVSNPLAGSAKRMSDPQADRRNADWLSASEKDHYEH
RLVTEDIATQLGELCTQLDVPQRPSLISTPALWHLSTRIEGTLADPTVSALQLACRLHPT
PAVCGFPTERARRLIRFVEPFERGLFTGMVGWCDAQGNGEWVVTIRCGTVKRNRVRLFAG
AGIVEASSPDSEWTEVQTKLGTMLRACGLAH