Protein Info for AO353_24000 in Pseudomonas fluorescens FW300-N2E3
Annotation: isochorismate synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 43% identical to AMOA_AERHY: Putative isochorismate synthase (amoA) from Aeromonas hydrophila
KEGG orthology group: K02361, isochorismate synthase [EC: 5.4.4.2] (inferred from 76% identity to pen:PSEEN2504)Predicted SEED Role
No annotation
MetaCyc Pathways
- superpathway of chorismate metabolism (43/59 steps found)
- salicylate biosynthesis I (2/2 steps found)
- 2,3-dihydroxybenzoate biosynthesis (2/3 steps found)
- salicylate biosynthesis II (2/3 steps found)
- enterobactin biosynthesis (5/11 steps found)
- 2-carboxy-1,4-naphthoquinol biosynthesis (2/7 steps found)
- superpathway of menaquinol-8 biosynthesis I (4/10 steps found)
- superpathway of demethylmenaquinol-8 biosynthesis I (3/9 steps found)
- superpathway of menaquinol-10 biosynthesis (3/10 steps found)
- superpathway of menaquinol-11 biosynthesis (3/10 steps found)
- superpathway of menaquinol-12 biosynthesis (3/10 steps found)
- superpathway of menaquinol-13 biosynthesis (3/10 steps found)
- superpathway of menaquinol-6 biosynthesis (3/10 steps found)
- superpathway of menaquinol-7 biosynthesis (3/10 steps found)
- superpathway of menaquinol-9 biosynthesis (3/10 steps found)
- superpathway of demethylmenaquinol-6 biosynthesis I (2/9 steps found)
- superpathway of demethylmenaquinol-9 biosynthesis (2/9 steps found)
- vibriobactin biosynthesis (2/9 steps found)
- bacillibactin biosynthesis (4/12 steps found)
- superpathway of phylloquinol biosynthesis (3/15 steps found)
KEGG Metabolic Maps
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of siderophore group nonribosomal peptides
- Ubiquinone and menaquinone biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 5.4.4.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0N9X096 at UniProt or InterPro
Protein Sequence (391 amino acids)
>AO353_24000 isochorismate synthase (Pseudomonas fluorescens FW300-N2E3) MRSGTLRANDTDEVQAIDEKESFSFTSGDRELTVAGMLQRIETPAIGGENANSLFQKTVM QALDRARKAGQSNPIIVGAIPFDPAEASCLYIPEHAEWRTRSATVQTDVAALPELIEQKN IPDEQGFKRAVEHAIVNFRHSDVRKAVLSVQRELVFAQDVDVGAMQNNLRAQNQSGYHFR VPMPDGATLIGVSPELLVHKDGLNFVSNPLAGSAKRMSDPQADRRNADWLSASEKDHYEH RLVTEDIATQLGELCTQLDVPQRPSLISTPALWHLSTRIEGTLADPTVSALQLACRLHPT PAVCGFPTERARRLIRFVEPFERGLFTGMVGWCDAQGNGEWVVTIRCGTVKRNRVRLFAG AGIVEASSPDSEWTEVQTKLGTMLRACGLAH