Protein Info for AO353_23990 in Pseudomonas fluorescens FW300-N2E3

Annotation: histidine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF00155: Aminotran_1_2" amino acids 47 to 332 (286 residues), 27.3 bits, see alignment E=2.1e-10 PF00282: Pyridoxal_deC" amino acids 112 to 313 (202 residues), 88.8 bits, see alignment E=3.2e-29

Best Hits

Swiss-Prot: 86% identical to DCHS_PSEFL: Histidine decarboxylase (hdc) from Pseudomonas fluorescens

KEGG orthology group: K01590, histidine decarboxylase [EC: 4.1.1.22] (inferred from 83% identity to pen:PSEEN2506)

MetaCyc: 76% identical to histidine decarboxylase subunit (Klebsiella aerogenes)
Histidine decarboxylase. [EC: 4.1.1.22]

Predicted SEED Role

"Histidine decarboxylase (EC 4.1.1.22)" (EC 4.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WMU0 at UniProt or InterPro

Protein Sequence (408 amino acids)

>AO353_23990 histidine decarboxylase (Pseudomonas fluorescens FW300-N2E3)
MTLSTADQSRLERFWQHCVTNQYFNIGYPESADFDYSQLHRFLRFSINNCGDWNEYSNYL
LNSFDFEKDVMTYFSELFNIALEDSWGYVTNGGTEGNMFGCYLGRELFPNGTLYYSKDTH
YSVAKIVKLLRIKCRAVESLANGEIDYDDLMAKITADQERHPIIFANIGTTLRGAVDNIA
TIQQRLQQAGIARHDYYLHADAALSGMILPFVDHPQPFSFADGIDSICVSGHKMIGSPIP
CGIVVAKRKDVARISVEVDYILAHDKTISGSRNGHTPLMMWAALRSHSFADWRQRVHHSL
EKAQYAVDRFQAAGIDAWRNENSITVVFPCPSQRIAKKYCLAVSGDTAHLITTPHHHDNV
MIDALIDEVITELETDAWQFGGAHVKQGGNERRPSNSVRETCPRFDVI