Protein Info for AO353_23940 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 711 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details amino acids 406 to 425 (20 residues), see Phobius details amino acids 437 to 456 (20 residues), see Phobius details amino acids 459 to 459 (1 residues), see Phobius details amino acids 461 to 478 (18 residues), see Phobius details amino acids 484 to 501 (18 residues), see Phobius details amino acids 515 to 536 (22 residues), see Phobius details PF04632: FUSC" amino acids 19 to 668 (650 residues), 454.5 bits, see alignment E=7.8e-140 PF13515: FUSC_2" amino acids 32 to 162 (131 residues), 46.6 bits, see alignment E=3.7e-16

Best Hits

KEGG orthology group: None (inferred from 75% identity to pfo:Pfl01_2655)

Predicted SEED Role

"FIG00958550: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VZ48 at UniProt or InterPro

Protein Sequence (711 amino acids)

>AO353_23940 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MQALLQYFKAILHPGPGVLLFALRTITAGLLTLYLAFVFDLDQPKWSIMAVVIVSQPLAG
MALARSFGQVIGTTLGAAVAVVIMAIFPQAPVPFVMTLSLWLALCTAGGTLLRYTSSQAF
VLSGYTAVVVGLLAVPDLEGTFLLAVTRVTETLLAVACVCVVSLLTARPEAVAKDYFARI
DQVIKLLATHASAVIRTEESEEDFHRRQMQLLGQISALEGVRRHLYYDAPRLRSADDLVQ
LLGNQLLLLTARLTALRHQRELLLERWEGEIPAEIQHLLNEELTFLDELARQGRALSSEQ
RHQFAALQQRFDALAYRSEQLTEPLKATLRSLSWSLRWEQARMLQQLETILELSDAIQSG
RKASSVFRGQANPLHLDFTLATMNAIRAFCALMVAGLIWIETGWDGARGGMIVAGILCSL
MATFPRPLLAAQSYARGLGLALVVSALLEFALVPMISSFELLALLLAPLLYAVAVGLSSP
PTTGTGIGLGLSTFLLLGPQNTGLGQNTAIQWFEFAGAYTCATVLALSVYALIFPFRPVL
RIRRLHQENCEQVYALLKKPATDENQFAFESRLVDRLTTMLGLLPAIQDKPARDLFEVSL
GCLALGIALNQLRQQGQNNLLLSPQTQTRLFATVQEVGRLVAGRPNIEVDRVIDSLHALG
DELDALHCSVHEHLWSVFRMRVALLIVVSFLERHRGHFEPVTLQGVPALDH