Protein Info for AO353_23650 in Pseudomonas fluorescens FW300-N2E3

Annotation: 3-carboxymuconate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF10282: Lactonase" amino acids 30 to 387 (358 residues), 381.7 bits, see alignment E=1.8e-118

Best Hits

KEGG orthology group: None (inferred from 81% identity to pba:PSEBR_a3262)

Predicted SEED Role

"3-carboxymuconate cyclase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WPL2 at UniProt or InterPro

Protein Sequence (391 amino acids)

>AO353_23650 3-carboxymuconate cyclase (Pseudomonas fluorescens FW300-N2E3)
MKMRKLWPLLMAGSVGAMGLSSASAESFQLLVGTYTQGQSQGIYRLKFDSQSGQLDATPL
QVVKSANPSWLTLSSDQRRLFVVNENGPGQADPVGRVSSFAVEPNTHALSLINQVQSLGN
EPTHSSLSADGKYLFVSNYSVAEDPGGNLAALPVSTDGKLAPPVQLSSHQPSRVNPERQM
SAHVHSTVSSPDGQYVFANDLGADKVFVYRYDPKANPERPLTAATPASVQLPPGSGPRHL
LFSADGKHAYLTLEMSAQVAVFDYQAGKLTQRQMVDLAAGKPAAQKAAAALHASSDGKFL
YVSNRGTTNELLVFAIDPASGELKELQRRPVEGDHPREFSLDPSGKFVLVANQKSNQIVI
IARDVKTGLLGKTVQKLPFDSPSDIKFFLRQ