Protein Info for AO353_23515 in Pseudomonas fluorescens FW300-N2E3

Annotation: muconate cycloisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR02534: muconate and chloromuconate cycloisomerases" amino acids 6 to 373 (368 residues), 526.6 bits, see alignment E=1.7e-162 PF02746: MR_MLE_N" amino acids 9 to 129 (121 residues), 123.3 bits, see alignment E=6.1e-40 PF13378: MR_MLE_C" amino acids 151 to 365 (215 residues), 180.3 bits, see alignment E=4.4e-57

Best Hits

Swiss-Prot: 77% identical to CATB_PSEPU: Muconate cycloisomerase 1 (catB) from Pseudomonas putida

KEGG orthology group: K01856, muconate cycloisomerase [EC: 5.5.1.1] (inferred from 93% identity to pfl:PFL_3862)

MetaCyc: 93% identical to muconate cycloisomerase (Pseudomonas reinekei)
Muconate cycloisomerase. [EC: 5.5.1.1]

Predicted SEED Role

"Muconate cycloisomerase (EC 5.5.1.1)" in subsystem Catechol branch of beta-ketoadipate pathway or Muconate lactonizing enzyme family (EC 5.5.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X020 at UniProt or InterPro

Protein Sequence (382 amino acids)

>AO353_23515 muconate cycloisomerase (Pseudomonas fluorescens FW300-N2E3)
MLSSAIESIETIIVDLPTIRPHKLAMHTMQNQTLVIIRVRCADGIEGIGESTTIGGLAYG
NESPDSIKTNIDKHFAPLLLGQDACNINAAMLRLERSIRGNTFAKSGIETALLDAHGKRL
GLPVSELLGGRVRDSLPVAWTLASGDTAKDIAEAEQMLDLRRHRIFKLKIGAGEVDRDLA
HVIAIKKALGDRASVRVDVNQAWDEAVALRACRILGGNGIDLIEQPISRNNRAGMVRLNA
MSPAPIMADESIECVEDAFNLAREGAASVFALKIAKNGGPRAVLRTAAIAEAAGIGLYGG
TMLEGGIGTLASAHAFLTLNELSWDTELFGPLLLTEDILSEPPVYCDFHLHVSQAPGLGL
SLDEERLAFFRRDKTSTAIHSA