Protein Info for AO353_23485 in Pseudomonas fluorescens FW300-N2E3

Annotation: lytic transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF06474: MLTD_N" amino acids 1 to 34 (34 residues), 59.9 bits, see alignment (E = 3.3e-20) PF01464: SLT" amino acids 124 to 224 (101 residues), 91 bits, see alignment E=6.3e-30 PF01476: LysM" amino acids 364 to 404 (41 residues), 48.1 bits, see alignment 1.3e-16 amino acids 432 to 473 (42 residues), 38.4 bits, see alignment 1.4e-13

Best Hits

KEGG orthology group: K08307, membrane-bound lytic murein transglycosylase D [EC: 3.2.1.-] (inferred from 85% identity to pfo:Pfl01_2183)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase D precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W9P4 at UniProt or InterPro

Protein Sequence (477 amino acids)

>AO353_23485 lytic transglycosylase (Pseudomonas fluorescens FW300-N2E3)
MSSSIRKSINSDALTRLAQAIAVAVSATLAGCQSTSQVPQTDVAHTLSTRTKQKPIWINE
KPSPQAAQDVWERMRQGFQLQDGLGVNPRIEQQRLWFASNPSFLQGASERGSLYIHYIVE
RLEERNMPLELALLPVIESAYNPMAYSRADAVGLWQFIPSTGRYFNLRQTRFYDGRRDIT
ASTIAAMDYLTRLHDMFNGDWLLALAAYNAGEGTVSRAIERNEKLGLPTDYWNLPLPAET
QAYVPKLLALSQVVLSPEAYGVNLNPIANQPYFEVVEINQRMDLSKVAAVANIDEDELFQ
LNPAFKQRTTIDGPQHLLVPTSKAQLLTASLSTMKPEELISQRPLKPVFEGADDRELATL
KRSYRVKRGDNLTQIAKANKVEVKDLQHWNKLNGKDLKVGQTLVMRDTSKSKRSGGRIST
VVAANSKKQTQYKVKQGDSLYIVAKRFNVEMQHLKRWNPRVGQALKPGQVLTVSSPR