Protein Info for AO353_23290 in Pseudomonas fluorescens FW300-N2E3

Annotation: cystathionine beta-synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00291: PALP
  • amino acids 11 to 303 (293 residues), 245.6 bits, E=7.3e-77
• PF00571: CBS
  • amino acids 344 to 389 (46 residues), 34.1 bits, 2.9e-12
  • amino acids 402 to 453 (52 residues), 21.2 bits, 3e-08

Best Hits

KEGG orthology group: K01697, cystathionine beta-synthase [EC: 4.2.1.22] (inferred from 91% identity to pfo:Pfl01_3248)

Predicted SEED Role

"Cystathionine beta-synthase (EC 4.2.1.22)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.2.1.22)

MetaCyc Pathways

• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
• L-cysteine biosynthesis III (from L-homocysteine) (2/2 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
• homocysteine and cysteine interconversion (3/4 steps found)
• hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
• taurine biosynthesis III (1/3 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.22

Sequence Analysis Tools

See A0A0N9WKL5 at UniProt or InterPro

Protein Sequence (458 amino acids)

>AO353_23290 cystathionine beta-synthase (Pseudomonas fluorescens FW300-N2E3)
MPNNSRPAVLGLIGNTPLVRVSRFDTGPCTLFLKLESQNPGGSIKDRIGLAMIDAAERDG
RLQPGGTIVEATAGNTGLGLALVGRAKGYRVVLVVPDKMSTEKVLHLKAMGAEVHITRSD
VGKGHPEYYQDVAARLAQEIPDAFFADQFNNPANPLAHECSTAPEIWAQAEHDLDAIVVG
VGSAGTLTGLTRFFRRVQPDLEMVLADPVGSVMAEYSRSGTLGTPGSWAVEGIGEDFIPS
IADLSSVRQAYSISDEESFDHARQLLRAEGILGGSSTGTLLAAALRYCREQTEPKRVVSF
VCDTGTRYLSKIYNDQWMTDQGLLARKRYGDLRDLIARRFEDGRVISVGPDDTLLTAFQR
MRLADVSQLPVLVGGKRLVGVIDESDILLGVHKDASHFRMTVASAMTDKVETLPPGASLA
ELQAELDRGLVAVIADASGFHGLITRVDMLNHLRRSLT