Protein Info for AO353_23270 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details PF00892: EamA" amino acids 4 to 138 (135 residues), 64.6 bits, see alignment E=5.4e-22 amino acids 151 to 280 (130 residues), 43.4 bits, see alignment E=2e-15

Best Hits

KEGG orthology group: None (inferred from 77% identity to pen:PSEEN4649)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WPE8 at UniProt or InterPro

Protein Sequence (346 amino acids)

>AO353_23270 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MNLSIFYALSAAALFGASTPLAKLLGVEVSPILLAGLLYLGSGLGLTLVRFIRDRGWQAT
GLTAGEWPWLIGAIAFGGVLGPVALMFGLTLTSGATASLMLNLESVLTALLAWLVFKENA
DRRIVAGMLAIVAGGVFLAWPQDSTHAQGWIGPLAVALACACWAIDNNLTRKISASDALF
IAGIKGLVAGAVNCTLALSLGAKLPNIATLAPILLVGFLGYGISLVLFVLALRGLGTART
GAYFSTAPFLGAAIAILILGEPASLTFWIAALLMGIGVWIHLTESHAHDHQHEPLIHGHR
HVHDEHHQHEHDFEWDGSEPHSHVHQHQAIRHSHPHYPDIHHRHKH