Protein Info for AO353_23105 in Pseudomonas fluorescens FW300-N2E3

Annotation: dienelactone hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details PF23678: YqhI" amino acids 1 to 35 (35 residues), 67.6 bits, see alignment 1.4e-22 PF01738: DLH" amino acids 85 to 294 (210 residues), 172.1 bits, see alignment E=3.9e-54 PF02129: Peptidase_S15" amino acids 90 to 207 (118 residues), 29.4 bits, see alignment E=2e-10 PF00326: Peptidase_S9" amino acids 216 to 284 (69 residues), 23.5 bits, see alignment E=1.1e-08

Best Hits

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 86% identity to psp:PSPPH_2691)

Predicted SEED Role

"Dienelactone hydrolase family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WMB3 at UniProt or InterPro

Protein Sequence (295 amino acids)

>AO353_23105 dienelactone hydrolase (Pseudomonas fluorescens FW300-N2E3)
MNRLTAKDFAPELLELYDYYAHGMINRREFLDRAVLFTLGGLTASALLAALSPNYALAEQ
VPITDPDIIAEYLTYPSPKGHGQVRGYRVRPAKASGKVPAVVVVHENRGLNPYIEDVARR
LAKAGFIALAPDGLTSVGGYPGNDEKGQELQQTVDPEKLMNDFFAAIEWLMKDDSTTGKI
GIVGFCYGGGVANAAAVAYPELGAAVSFYGRQPKAEEVIRIQAPLLLHYAELDTRTNEGW
PAFEQALKAAGKTYEAYIYPGANHGFHNDSTPRYDEAAARLAWSRTLDWFRRYLA