Protein Info for AO353_23075 in Pseudomonas fluorescens FW300-N2E3

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 38 to 65 (28 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details PF01810: LysE" amino acids 16 to 203 (188 residues), 86.8 bits, see alignment E=6.9e-29

Best Hits

KEGG orthology group: None (inferred from 88% identity to ppf:Pput_3569)

Predicted SEED Role

"transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H173 at UniProt or InterPro

Protein Sequence (208 amino acids)

>AO353_23075 lysine transporter LysE (Pseudomonas fluorescens FW300-N2E3)
VFPINIWLAYTAACLLLVLAPGPDNLLAVGRGLSQGRVAAIVSGMASGAGILFHVATASL
GLTLLMQTSAVAFWVVKLIGAGYLLWLGIKVLRSRSLISFQPATRQSLPSIFLTGLLSAA
LNPKPGFFVLAFIPQFVDPQRGSVSVQMLVYGIWFAALTAVGFALMGVFATALSRFLRQR
PRLVNGLNVGAGLTFVASGVSIAALSQK