Protein Info for AO353_23035 in Pseudomonas fluorescens FW300-N2E3

Annotation: D-alanyl-D-alanine dipeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01427: Peptidase_M15" amino acids 31 to 153 (123 residues), 66.3 bits, see alignment E=3.3e-22 amino acids 184 to 241 (58 residues), 60.8 bits, see alignment 1.6e-20 PF03734: YkuD" amino acids 288 to 447 (160 residues), 29.2 bits, see alignment E=1.3e-10

Best Hits

Predicted SEED Role

"D-alanyl-D-alanine dipeptidase (EC 3.4.13.22)" (EC 3.4.13.22)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.13.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VY71 at UniProt or InterPro

Protein Sequence (472 amino acids)

>AO353_23035 D-alanyl-D-alanine dipeptidase (Pseudomonas fluorescens FW300-N2E3)
MRLLCRIKPLCLSMLAIIAPCLASAEPRPEHMVYLRAIDPGIEQDIRYASAHNFTGHPLD
GYGAAECLLSLDAAKALARVQAALRTQGYGLKVFDCYRPSRAVADMGRFATQPGDPRKAE
FYPRVDKQDFWHLGYVARVSNHSKGGTVDLTLTGPEALPAQTWSPSAKQVDCAAPYEQRW
HDGAVDMGTGFDCFDERAHTDSSTINATAKANRQRLSNAMQKEGFSGYSKEWWHFTYTRN
DALKNVMDFPITAQALDTSNQLIVVTTKHWTDVQGTAQRYERQGKTFQKYGAPFPVVVGK
SGLAWGKGLGVVEQREGPVKREGDGKAPAGLFKLGTAFGYDSTADTRLPYLPLTPTTECV
DDSHSKRYNELVDGSTIAKDWNSSEHMRRDDDMYRQGIVIEHNTPASADAGSCIFFHIWR
APTSPTLGCTAMDPADIARLFGWLDPRQSPLLVQLPEAEYEHFRERWNLPQR