Protein Info for AO353_23000 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 138 to 155 (18 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details PF03988: DUF347" amino acids 20 to 70 (51 residues), 56.9 bits, see alignment 9.9e-20 amino acids 74 to 124 (51 residues), 53.3 bits, see alignment 1.3e-18 amino acids 139 to 185 (47 residues), 44.1 bits, see alignment 9.4e-16 amino acids 194 to 243 (50 residues), 45.1 bits, see alignment 4.6e-16

Best Hits

KEGG orthology group: None (inferred from 81% identity to pfl:PFL_4648)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VYR9 at UniProt or InterPro

Protein Sequence (255 amino acids)

>AO353_23000 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MKPLTKADWLNKVPEVTLSFWVIKIMSTTVGETGADFLAVDAGLGQGVTSIGMAVLLAIA
LFGQLRTRAYSPWIYWLTVVLVSVVGTQITDVLTDKMGISLYASTAVFSVLLAINFMIWY
GLERSLSITEIVTPRRELFYWATVLCTFALGTAAGDLATEALGLGFTLGAVIFGALIGVT
FAAWRLGGNTVLTFWIAYILTRPFGASLGDLLTQAKTYGGFGMGAMWTSAMFLSVILILV
AVAQMSVGNRKLVTE