Protein Info for AO353_22905 in Pseudomonas fluorescens FW300-N2E3

Annotation: RND transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 31 to 486 (456 residues), 444.1 bits, see alignment E=2.9e-137 PF02321: OEP" amino acids 87 to 277 (191 residues), 78.1 bits, see alignment E=4e-26 amino acids 301 to 484 (184 residues), 116 bits, see alignment E=9.3e-38

Best Hits

KEGG orthology group: None (inferred from 85% identity to pba:PSEBR_a2803)

Predicted SEED Role

"Heavy metal RND efflux outer membrane protein, CzcC family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0Q3 at UniProt or InterPro

Protein Sequence (497 amino acids)

>AO353_22905 RND transporter (Pseudomonas fluorescens FW300-N2E3)
MTDRCPLNLDAPMARRLVSARGSRLLSLSLSVLMLSACAIGPDYQRPTVAEPAQYKQADG
WRQATPSDSLARGAWWELYGDQQLNGLVEKLNSANQTVAQSEAQYRQAQALVRSARGAFF
PTVDLSAGKTRSSQGTGSSSSSLSSTNSGIRDTYNTQLGVSWEADVWGKLRRGLEADKAS
AQASFADLAAMRLSQQSELVQNYLQLRVIDQQKRLLQATVENYQRSLQMTENQYRAGVSG
KDAVAQAQTQLKSTQADMVDLIWQRAQFENAIAVLIGLPPADFNLAETQNIPALPQVPLS
LPSQLLERRPDIASAERSVIAANANIGVAKAAYYPDLTLSMSGGYSSSTYSNLISLPNRF
WSVGPKLAMTLFDGGQRSAEVDRTEAAYDQTVAKYRQTVLDGFREVENYLVQLKVMEDEA
AVRQEALDAARESLRLTLNQYKAGLIAYLDVVVVQATALSNERSVLTLQQSRLIASVNLI
AALGGGWDGQTQISEKN