Protein Info for AO353_22730 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF05643: GNA1162-like" amino acids 27 to 212 (186 residues), 300.6 bits, see alignment E=2e-94

Best Hits

Swiss-Prot: 51% identical to Y1124_NEIMB: Putative lipoprotein NMB1124/NMB1162 (NMB1124) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: None (inferred from 79% identity to pfs:PFLU0164)

Predicted SEED Role

"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0P9 at UniProt or InterPro

Protein Sequence (219 amino acids)

>AO353_22730 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MIARSLKLMAGLLALAVLGGCVSPKTVDYSAYKQSRPKTILVLPPLNNSPDVKASYSMLS
QVTYPLAEAGYYVLPIALVDETFHQNGLTTPADIHQAPANKLQEIFGADAALYITVTDYG
TRYMVISSATVVTASAKLVDLKTGTTLWTGSASASSEEGNNNSGGGLLGALITAAVKQVI
NSSTDAGHPIAGITSARLLSAGHPAGLLYGPRSPMYGTD