Protein Info for AO353_22700 in Pseudomonas fluorescens FW300-N2E3

Annotation: LexA family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 TIGR00498: repressor LexA" amino acids 4 to 204 (201 residues), 189.7 bits, see alignment E=2.2e-60 PF01726: LexA_DNA_bind" amino acids 4 to 68 (65 residues), 59.2 bits, see alignment E=2.9e-20 PF00717: Peptidase_S24" amino acids 84 to 198 (115 residues), 120.8 bits, see alignment E=2.5e-39

Best Hits

Swiss-Prot: 77% identical to LEXA2_PSESM: LexA repressor 2 (lexA2) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K01356, repressor LexA [EC: 3.4.21.88] (inferred from 86% identity to pfo:Pfl01_3152)

Predicted SEED Role

"SOS-response repressor and protease LexA (EC 3.4.21.88)" in subsystem DNA repair, bacterial (EC 3.4.21.88)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.88

Use Curated BLAST to search for 3.4.21.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VYM7 at UniProt or InterPro

Protein Sequence (205 amino acids)

>AO353_22700 LexA family transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MYSMTTLTPRRTAILTFIRDRIAQQGQSPSLAEISEAFGFASRSVARKHVVALTEAGFIE
VNPHQARGIRLLNQPRRPELLDIPVLGRVAAGVPMGVDAEVHSRLWLDPAMFSRTPDYLL
RVQGDSMIGDGILDGDLVGVRRSAEVRNGQIVVARLEGEVTIKRFERAGDSVRLLPRNPD
YSPIVVAADQDLAIEGVFCGLVRQG