Protein Info for AO353_22555 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 58 to 79 (22 residues), see Phobius details amino acids 95 to 122 (28 residues), see Phobius details amino acids 176 to 200 (25 residues), see Phobius details amino acids 224 to 249 (26 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details PF07690: MFS_1" amino acids 38 to 215 (178 residues), 79.2 bits, see alignment E=1.5e-26 amino acids 230 to 398 (169 residues), 50.8 bits, see alignment E=6.2e-18

Best Hits

KEGG orthology group: None (inferred from 88% identity to pfl:PFL_2136)

Predicted SEED Role

"Major facilitator superfamily precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0P5 at UniProt or InterPro

Protein Sequence (413 amino acids)

>AO353_22555 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MNDLKDEVSSLRAPQSADASVRRRSLVAGCGAHAVHDGLTDVIYVLLPIWQSQFGMSYAQ
IGLLRGVYAGMMAGFQLLASRAAKRWGRERMLVGGTALAGLAYLLAGQAGGLTVLLLALL
LGGLGASTQHPLASSLITDTYEAGGGVKQALSQYNFSGDIGKTLIPGLIGLLLTVISWRA
SVTLLGLLGLAAAGLLWWLIPARAEPLSTHGKATKAITGNGSAIGLRALILTGTLDSAVR
MGFLTFLPFLLKDKGAGTAGIGLALTMLFVGGAFGKLLCGYLGARIGMVKTVWLTEFTTA
VLIVMAVYLPFFGLMVMLPLLGLALNGTSSVLYGAVPDLAGPGKREQAFAVFYTGTIGGG
ALAPVLFGTLGDVTGVPVAVIMLAATLLLTLPLSWFVQRGLDADARSRYLFQD