Protein Info for AO353_22255 in Pseudomonas fluorescens FW300-N2E3

Annotation: chloroperoxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF00561: Abhydrolase_1" amino acids 22 to 256 (235 residues), 111 bits, see alignment E=2e-35 PF12146: Hydrolase_4" amino acids 23 to 130 (108 residues), 49.4 bits, see alignment E=1e-16 PF12697: Abhydrolase_6" amino acids 23 to 264 (242 residues), 71.4 bits, see alignment E=4.5e-23 PF00326: Peptidase_S9" amino acids 172 to 273 (102 residues), 29.2 bits, see alignment E=1.6e-10

Best Hits

Swiss-Prot: 89% identical to PRXC_PSEFL: Non-heme chloroperoxidase (cpo) from Pseudomonas fluorescens

KEGG orthology group: None (inferred from 83% identity to pba:PSEBR_a3603)

Predicted SEED Role

"Non-heme chloroperoxidase (EC 1.11.1.10)" (EC 1.11.1.10)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0N8 at UniProt or InterPro

Protein Sequence (274 amino acids)

>AO353_22255 chloroperoxidase (Pseudomonas fluorescens FW300-N2E3)
MSTFTTRDGTEIYYKDWGTGQPIVFSHGWPLNADSWESQMIYLASKGYRVIAHDRRGHGR
SSQPWSGNEMDTYADDLAQLIELLDLQNAVLFGFSTGGGEVARYIGRHGTGRIAKAGLIS
AVPPLMLKTEANPGGLPMEVFDGLRQASLADRSQLYKDVASGPFFGFNKPGAKPSQGMID
WFWMQGMTAGHKNAYDCIKAFSETDFTEDLKKFDVPTLVVHGDADQIVPIEAAGIASAKL
VKGSKLLVYPGAPHGLTDTHKDQLNADLLAFLKA