Protein Info for AO353_22220 in Pseudomonas fluorescens FW300-N2E3

Annotation: copper resistance protein CopC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13205: Big_5" amino acids 25 to 107 (83 residues), 29.4 bits, see alignment E=1.1e-10 PF04234: CopC" amino acids 26 to 126 (101 residues), 75.2 bits, see alignment E=6.9e-25

Best Hits

Swiss-Prot: 74% identical to COPC_PSEUB: Copper resistance protein C (copC) from Pseudomonas syringae pv. tomato

KEGG orthology group: K07156, (no description) (inferred from 73% identity to psb:Psyr_1495)

Predicted SEED Role

"Copper resistance protein C precursor" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VSV5 at UniProt or InterPro

Protein Sequence (127 amino acids)

>AO353_22220 copper resistance protein CopC (Pseudomonas fluorescens FW300-N2E3)
MSFLKTTTVAAVLTAGLLLSAVAQAHPKLLSSTPAESSDAAAPSKIELHFSENLTTQFSG
AKLIMTDMPGMPNSPMGVKAGVAGGSDPKTMVITPASPLTTGTYKVEWRAVSSDTHPMTG
NFSFKVK