Protein Info for AO353_22115 in Pseudomonas fluorescens FW300-N2E3

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF13145: Rotamase_2" amino acids 145 to 275 (131 residues), 36.1 bits, see alignment E=1.5e-12 PF13616: Rotamase_3" amino acids 165 to 263 (99 residues), 69.8 bits, see alignment E=4.5e-23 PF00639: Rotamase" amino acids 169 to 262 (94 residues), 75.7 bits, see alignment E=7.4e-25

Best Hits

KEGG orthology group: K03769, peptidyl-prolyl cis-trans isomerase C [EC: 5.2.1.8] (inferred from 81% identity to pba:PSEBR_a3144)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiD (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WK33 at UniProt or InterPro

Protein Sequence (319 amino acids)

>AO353_22115 peptidylprolyl isomerase (Pseudomonas fluorescens FW300-N2E3)
MSGGCGCGGGNGGSGGCGSSKQTQPDVVDIAPTGAVQFDALPVAPAAHDAPAQLIASSEQ
EWPIISVNAVSITPEAMAQELQYHPAESREEAVYLAARALVIRELLQQRIAELGVSLEVG
SGENEEEAATRLLLEREVQVPQCDEETSLRYYENNRGRFHSAPLLAVRHILLECAPDDAE
ARALAHVQAEVLLQRLEDFPGSFAEMAVKYSACPSKAQGGSLGQISKGQTVPELERQLFT
LAPGLASKPLESRYGWHVVSVDQRVEGMPLPYEVVSTAIRTQLQQGVWQKALVQYLQTLI
GAADIRGIHLQGADSPLVQ