Protein Info for AO353_21980 in Pseudomonas fluorescens FW300-N2E3

Annotation: cytochrome C oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details PF00510: COX3" amino acids 20 to 193 (174 residues), 50.8 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: K02164, nitric oxide reductase NorE protein (inferred from 74% identity to pba:PSEBR_a3170)

Predicted SEED Role

"Nitric oxide reductase activation protein NorE" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VSR1 at UniProt or InterPro

Protein Sequence (195 amino acids)

>AO353_21980 cytochrome C oxidase (Pseudomonas fluorescens FW300-N2E3)
MSTSAESRGVVRGHLPGDLAMWFFILAELSVFAVLILAFAVTQALKPQLFGESRLLLYTS
TGLAMTLSLLTAGLFAALAQEQVRRSRSRHGAVLLLAALLAGSVYVVLKLTEYQHLLASG
LGMEHNTFFTLYWILTGFHFLHVLLGMVILGWLAERCRCGLYNEDNRSGFESGVLYWHMV
DLIWVVLFPLVYVLN