Protein Info for AO353_21965 in Pseudomonas fluorescens FW300-N2E3

Annotation: cytochrome C biogenesis protein CcsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00034: Cytochrom_C" amino acids 24 to 104 (81 residues), 39.3 bits, see alignment E=1.4e-13 PF13442: Cytochrome_CBB3" amino acids 26 to 100 (75 residues), 30.1 bits, see alignment E=5.1e-11

Best Hits

Swiss-Prot: 73% identical to CY551_PSEST: Cytochrome c-551 (nirM) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 69% identity to psa:PST_3529)

Predicted SEED Role

"membrane c-type cytochrome cy" in subsystem Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0N1 at UniProt or InterPro

Protein Sequence (104 amino acids)

>AO353_21965 cytochrome C biogenesis protein CcsA (Pseudomonas fluorescens FW300-N2E3)
MKNTLISLIVLAGALSLQPVMAQDAPELFKSKPCAACHAIDTKLVGPALKEVATKNAGVA
GAADTLANHIKNGTQGNWGPIPMPANPVTDEEAQTLSTWVLSLK