Protein Info for AO353_21770 in Pseudomonas fluorescens FW300-N2E3

Annotation: 3-hydroxybutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00106: adh_short" amino acids 7 to 197 (191 residues), 185.2 bits, see alignment E=1.5e-58 TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 7 to 257 (251 residues), 342.3 bits, see alignment E=7.6e-107 PF08659: KR" amino acids 8 to 157 (150 residues), 45.1 bits, see alignment E=1.7e-15 PF13561: adh_short_C2" amino acids 15 to 254 (240 residues), 180.4 bits, see alignment E=6.7e-57

Best Hits

Swiss-Prot: 66% identical to BDHA_CUPNH: D-beta-hydroxybutyrate dehydrogenase (hbdH1) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 95% identity to pfo:Pfl01_3079)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WMN3 at UniProt or InterPro

Protein Sequence (257 amino acids)

>AO353_21770 3-hydroxybutyrate dehydrogenase (Pseudomonas fluorescens FW300-N2E3)
MTTLSGKTALVTGSTSGIGLGIALSLAKAGANLILNGFGDASTVIAQVQQFGGKVGHHPA
DVSDPAQIAEMIAYAEREFGGVDILVNNAGIQHVSAVEDFPVERWDSIIAINLSSVFHST
RLSLPGMRAKGWGRIVNIASVHGQVGSVGKAAYVAAKHGVIGLTKVVGLETATSNVTCNA
ICPGWVLTPLVQKQIDDRAAAGIDPQQAQHDLLAEKQPSLEFVTPSQLGELVLFLCSEAG
SQVRGAAWNIDGGWLAQ