Protein Info for AO353_21735 in Pseudomonas fluorescens FW300-N2E3

Annotation: IclR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF09339: HTH_IclR" amino acids 13 to 61 (49 residues), 46.2 bits, see alignment 3.2e-16 PF01614: IclR" amino acids 128 to 249 (122 residues), 29.3 bits, see alignment E=7.3e-11

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a1963)

Predicted SEED Role

"Transcriptional regulator, IclR family" in subsystem Homogentisate pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WNQ0 at UniProt or InterPro

Protein Sequence (254 amino acids)

>AO353_21735 IclR family transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MTEDTIKRRARGLDRAFDILDFLKEIGQPLRPNDIASGIGSPKSTVYELVASLLERRILE
PVGKEGHVYLGRQLYFLGQAHLRHFDLSREADHALQEIVSQTRETAQMCLLNGRKYTVAL
MKEGERHFRISSDIGENAPIPWTASGRLLLAHLSDQQIVDLIDEDDFILPDGERLPLERF
LAEIRQAAIDGFFSFDSVADTFTHCFAAPVKDPSGVAIATLCIVAPRADAKNNYNDYRRV
LIESANNLARRINE