Protein Info for AO353_21725 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): ABC transporter for D-glucosamine, ATPase component
Rationale: Reannotated based on fitness data for other genes in the operon. We have no fitness data for this gene.
Original annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF00005: ABC_tran" amino acids 31 to 188 (158 residues), 115.4 bits, see alignment E=3.2e-37

Best Hits

Swiss-Prot: 50% identical to GLNQ_ECOLI: Glutamine transport ATP-binding protein GlnQ (glnQ) from Escherichia coli (strain K12)

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 92% identity to pfo:Pfl01_3089)

MetaCyc: 50% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"ABC-type polar amino acid transport system, ATPase component"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21 or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WZ99 at UniProt or InterPro

Protein Sequence (265 amino acids)

>AO353_21725 ABC transporter for D-glucosamine, ATPase component (Pseudomonas fluorescens FW300-N2E3)
MTQAQVSTQNASQALLEIRDLHKQYGPLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRC
VNMLEEFQGGQILLDGESIGYHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQ
NVTLGLLKVKKLHKDEAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPS
LMLFDEVTSALDPELVGEVLSVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEE
QGPPKELFERPQSPRLAEFLKNTRF