Protein Info for AO353_21720 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): ABC transporter for D-glucosamine, permease component 2
Rationale: Specifically important in nitrogen source D-Glucosamine Hydrochloride; carbon source D-Glucosamine Hydrochloride
Original annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 24 to 52 (29 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 17 to 112 (96 residues), 83.2 bits, see alignment E=7.5e-28 PF00528: BPD_transp_1" amino acids 36 to 217 (182 residues), 81.9 bits, see alignment E=2.5e-27

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 95% identity to pba:PSEBR_a1960)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WLR5 at UniProt or InterPro

Protein Sequence (220 amino acids)

>AO353_21720 ABC transporter for D-glucosamine, permease component 2 (Pseudomonas fluorescens FW300-N2E3)
MYESPSWLHELWVARDTLWSGFLTSVQCSVLAIMLGTLIGIVAGLVLTYGTLWMRAPFRF
YVDLIRGTPVFVLVLACFYMAPALGWQIDAFQAGVLGLTLFCGSHVAEIVRGALQALPRG
QMEASKAIGLTFYQALAYVLLPQALRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQ
IIARTFMTLEFYLFAGFLFFIINYAIELLGRHIEKRVALP