Protein Info for AO353_21715 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): ABC transporter for D-glucosamine, permease component 1
Rationale: Specifically important in nitrogen source D-Glucosamine Hydrochloride; carbon source D-Glucosamine Hydrochloride
Original annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 155 to 156 (2 residues), see Phobius details amino acids 158 to 170 (13 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 111 (97 residues), 97.4 bits, see alignment E=2.9e-32 PF00528: BPD_transp_1" amino acids 35 to 216 (182 residues), 80.6 bits, see alignment E=6.2e-27

Best Hits

Swiss-Prot: 38% identical to YECS_SHIFL: L-cystine transport system permease protein YecS (yecS) from Shigella flexneri

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 99% identity to pfo:Pfl01_3091)

MetaCyc: 38% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0M5 at UniProt or InterPro

Protein Sequence (220 amino acids)

>AO353_21715 ABC transporter for D-glucosamine, permease component 1 (Pseudomonas fluorescens FW300-N2E3)
MNYQLNFAAVWRDFDTLLAGLGLGLELALVSIAIGCVIGLLMAFALLSKHRALRVLASVY
VTVIRNTPILVLILLIYFALPSLGIRLDKLPSFIITLSLYAGAYLTEVFRGGLLSIPKGL
REAGLAIGLGEWQVKAYVTVPVMLRNVLPALSNNFISLFKDTSLAAAIAVPELTYYARKI
NVESYRVIETWLVTTALYVAACYLIAMLLRYLEQRLAIRR