Protein Info for AO353_21690 in Pseudomonas fluorescens FW300-N2E3

Annotation: 2,4-dienoyl-CoA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 311 to 332 (22 residues), see Phobius details amino acids 379 to 395 (17 residues), see Phobius details PF00724: Oxidored_FMN" amino acids 9 to 333 (325 residues), 166.8 bits, see alignment E=8.2e-53

Best Hits

KEGG orthology group: None (inferred from 72% identity to pfs:PFLU2654)

Predicted SEED Role

"2,4-dienoyl-CoA reductase [NADPH] (EC 1.3.1.34)" (EC 1.3.1.34)

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.34

Use Curated BLAST to search for 1.3.1.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W8Z8 at UniProt or InterPro

Protein Sequence (407 amino acids)

>AO353_21690 2,4-dienoyl-CoA reductase (Pseudomonas fluorescens FW300-N2E3)
MSPFHALNLPNGQTIGNRIAKAAMEENLADTDQAPSQALMQLYRAWADGEAGLLLTGNVM
IDRRTMTGPGGVVLEDERHLERFRQWAAIGRAKGAQFWMQLNHPGRQTMANLGQPAWAPS
AVALEMGQFSKMFAQPTPMSEDNIQEVIQRFASSAALAEKAGFTGVEIHAAHGYLISQFL
SPLSNRRTDRWGGSLENRARLLIEVVNAVRAAVTTDFCVAVKLNSADFQRGGFDADDARQ
VIDLLNPLAIDLLELSGGSYEAPAMQGEARDGRTLAREAYFLEMAGELASRAQMPVMVTG
GIRRLPVVEQVLASGIAMAGIGTALAVEPLLVKLWREGHDSHPQLPPITWKRKPLAALAN
MAVVRFQIQRLSRGRQPKPAVSALWALILDQLYIAKRTRQYRAAMSK