Protein Info for AO353_21655 in Pseudomonas fluorescens FW300-N2E3

Annotation: cobalamin biosynthesis protein CobW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR02475: cobalamin biosynthesis protein CobW" amino acids 5 to 348 (344 residues), 531.2 bits, see alignment E=4.5e-164 PF02492: cobW" amino acids 8 to 215 (208 residues), 195.3 bits, see alignment E=7.3e-62 PF07683: CobW_C" amino acids 271 to 353 (83 residues), 62.2 bits, see alignment E=3.4e-21

Best Hits

Swiss-Prot: 78% identical to COBW_PSEAE: Protein CobW (cobW) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02234, cobalamin biosynthesis protein CobW (inferred from 98% identity to pba:PSEBR_a1953)

Predicted SEED Role

"CobW GTPase involved in cobalt insertion for B12 biosynthesis" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WLP9 at UniProt or InterPro

Protein Sequence (355 amino acids)

>AO353_21655 cobalamin biosynthesis protein CobW (Pseudomonas fluorescens FW300-N2E3)
MKTLAKLPVTIVTGFLGSGKTTLLRHMLDNAQGRRIAVIVNEFGELGIDGEILKQCSIGC
TEEEANGRVYELANGCLCCTVQEEFFPVMRELVARRGDLDHILIETSGLALPKPLVQAFQ
WPEIRSACTVDAVITVVDSPAVAAGTFAAFPDQVDAQRKLDPNLDHESPLHELFADQLAS
ADLVILNKADLISPADLAKVRLEVAEELPPAVKIIEASSGRLPLDVLIGLGAGSEEHIDG
RHSHHDHHHDGDDHDDHDHDAFDSISIELPQADESLLLDALTQLVVQHGILRVKGFAAIP
NKPMRLLIQGVGTRFDKHFDRQWGADEARSTRLVLIGQQLDAVLLEAQLRAALSV