Protein Info for AO353_21525 in Pseudomonas fluorescens FW300-N2E3

Annotation: ClpV1 family T6SS ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 849 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 10 to 849 (840 residues), 1129.7 bits, see alignment E=0 PF02861: Clp_N" amino acids 21 to 72 (52 residues), 43.2 bits, see alignment 2.1e-14 PF00004: AAA" amino acids 220 to 331 (112 residues), 37.6 bits, see alignment E=1.8e-12 amino acids 617 to 724 (108 residues), 33.3 bits, see alignment E=3.8e-11 PF17871: AAA_lid_9" amino acids 362 to 454 (93 residues), 107.2 bits, see alignment E=2.3e-34 PF07724: AAA_2" amino acids 611 to 775 (165 residues), 174.7 bits, see alignment E=1e-54 PF07728: AAA_5" amino acids 616 to 734 (119 residues), 39.8 bits, see alignment E=2.8e-13

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 93% identity to pfo:Pfl01_3412)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WJT0 at UniProt or InterPro

Protein Sequence (849 amino acids)

>AO353_21525 ClpV1 family T6SS ATPase (Pseudomonas fluorescens FW300-N2E3)
MELASLIGRLNPDNRRALERAAQRCLQRGHHYVEIEHLLLELLEIEGGDFAYLLPRFGLE
RDALTAEINKALELFKTGSTRTPALSAHTIGLLEDAVVQASVLGLESIRSGLLLLALLDR
DERRSLLLNSASSLLRIPRDALRNNLLEWTESSREHVGAARAVAATAGKPQQKQDSILDQ
FTQDLTADAHAGRIDPIVGRDGEIRQCIDILLRRRQNNPILVGAPGVGKTAVVEGLALRI
AAGDVPPSLQEVSLRVLDLGLLQAGAGVKGEFEQRLKGVIDAVRSAEKPIILFIDEAHTL
IGAGGVEGGSDAANLLKPALARGELRTLAATTWLEYKKYFEKDPALARRFQLVQVEEPDE
ITAVEMLRGVAAKLEQHHGVQVLDAAIHEAVKLSHRYISGRQLPDKAISVLDTACARVAL
GQHDVPPPLESLRHRQQSLKDEVERLRREQATGLDHRERITVLETESTSNVQAIRELEIR
WSEERVAVRELLETRRELLDLSERADSDKPDDVTDGRLDHLAAELLRLEAGLDAIRQDDP
LVPEQVDAKTVAAVIAGWTGIPVGKMLADEAHAVRTLGQRMSQRVMGQRTALNTIAQRLQ
AYRAGLTDPQKPVGVFLLVGPTGVGKTETAYALADALYGGERNLISINLSEYQEAHTVSQ
LKGAPPGYVGYGSGGVLTEAVRRKPYSVVLLDEIEKAHPDVLEAFYNVFDKGLMEDGTGL
VVDFKNTVMLATSNVGAELLLDTPTAQLDSDAFTEALHSVLLKAFRPAFLARMTVVAYRP
LDEATLEGIVLAKLEKLRGRYKAATGKQFEFDAGIVQAVLAKCSAAGARDVENVLMTQVT
GKLAEWVLE