Protein Info for AO353_21470 in Pseudomonas fluorescens FW300-N2E3

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 972 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 54 to 71 (18 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 133 to 150 (18 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details amino acids 459 to 484 (26 residues), see Phobius details amino acids 503 to 523 (21 residues), see Phobius details amino acids 573 to 591 (19 residues), see Phobius details amino acids 602 to 624 (23 residues), see Phobius details amino acids 631 to 651 (21 residues), see Phobius details amino acids 657 to 678 (22 residues), see Phobius details amino acids 703 to 721 (19 residues), see Phobius details amino acids 759 to 777 (19 residues), see Phobius details amino acids 816 to 840 (25 residues), see Phobius details amino acids 849 to 868 (20 residues), see Phobius details amino acids 887 to 907 (21 residues), see Phobius details amino acids 927 to 949 (23 residues), see Phobius details PF00662: Proton_antipo_N" amino acids 64 to 110 (47 residues), 36.6 bits, see alignment 8.4e-13 PF00361: Proton_antipo_M" amino acids 126 to 399 (274 residues), 213.8 bits, see alignment E=8.1e-67 PF13244: MbhD" amino acids 615 to 680 (66 residues), 68.4 bits, see alignment 1.2e-22 PF20501: MbhE" amino acids 698 to 794 (97 residues), 145.8 bits, see alignment E=8.5e-47 PF04039: MnhB" amino acids 821 to 943 (123 residues), 122.1 bits, see alignment E=4.5e-39

Best Hits

KEGG orthology group: K05559, multicomponent K+:H+ antiporter subunit A (inferred from 71% identity to aaa:Acav_1966)

Predicted SEED Role

"Na(+) H(+) antiporter subunit A; Na(+) H(+) antiporter subunit B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0L9 at UniProt or InterPro

Protein Sequence (972 amino acids)

>AO353_21470 cation:proton antiporter (Pseudomonas fluorescens FW300-N2E3)
MSLIVLLLLPFIGSCLAALLPHNARNTESILAGLVALIGTVQVALLYPQIAHGGVIREEF
FWLPSLGLNFVLRMDGFAWLFSMLVLGIGTLVSLYARYYMSPDDPVPRFFAFFLAFMGAM
LGLVISGNLIQMVFFWELTSLFSFLLIGYWHHRADARRGAYMALMVTGAGGLCLLAGVML
LGHVVGSYDLDKVLAAGDLIRAHALYPILLPLILIGALSKSAQFPFHFWLPHAMAAPTPV
SAYLHSATMVKAGVFLLARLWPSLSGSEEWFYIVSGAGACTLLLGAYCAMFQNDLKGLLA
YSTISHLGLITLLLGLNSPLAAVAAVFHILNHATFKASLFMAAGIIDHESGTRDIRKLSG
LIKLIPFTATLAMVASASMAGVPLLNGFLSKEMFFAETVFINASAWIETTLPIVATIAGT
FSVAYSLRFTVDVFFGPTATDLPHTPHEPPRWMRAPVELLVFACLVVGIFPAQVVGPLLA
AAALPVVGGTLPEYSLAIWHGWNAPMIMSLIAMSAGIVVYLLLRNQLKRGRFKYPPLIGR
LNGKRLFERGLVVMMRLARRLERRVSTKRLQTQLFLLVLVAVLAGLIPLLHSGLSWGERP
KIPGSIVFVTLWLLAIACALGAAWQAKYHRLAALTMVSVCGMMTCVTFVWFSAPDLALTQ
LVVEVVTTVLILLGLRWLPRRIEEVSPLPSSVPKARARRLRDLLLSGAVGIGMALLAYAM
LTRQTPNDISSFYLSRALPEGGGSNVVNVMLVDFRGFDTLGEITVLVAVALTVFALLRRF
RPPKESMQLPAQQRLLAPDVVTDLVNPRHASDTALGFMMVPAVLVRLLLPVAVVVSFYLF
MRGHNQPGGGFVAGLVMSVAFILQYMVAGTQWVEAQMSLRPVRWMGTGLLFATLTGLGAM
VAGYPFLTTHTWHFGLPLLGEIHIASALGFDIGVYAVVVGSTLLILTALAHQSVRGHKPG
SQPKPIAKPGAA