Protein Info for AO353_21345 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): 5-deoxy-D-glucuronate isomerase (EC 5.3.1.30)
Rationale: Specifically important for utilizing m-Inositol.
Original annotation: 5-deoxy-glucuronate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF04962: KduI" amino acids 5 to 266 (262 residues), 334.8 bits, see alignment E=1.8e-104 TIGR04378: 5-deoxy-glucuronate isomerase" amino acids 20 to 266 (247 residues), 309.7 bits, see alignment E=7.6e-97

Best Hits

Swiss-Prot: 54% identical to IOLB_BACSK: 5-deoxy-glucuronate isomerase (iolB) from Bacillus clausii (strain KSM-K16)

KEGG orthology group: K03337, 5-deoxy-glucuronate isomerase [EC: 5.3.1.-] (inferred from 89% identity to pba:PSEBR_a3354)

Predicted SEED Role

"5-deoxy-glucuronate isomerase (EC 5.3.1.-)" in subsystem Inositol catabolism (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.- or 5.3.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0L6 at UniProt or InterPro

Protein Sequence (269 amino acids)

>AO353_21345 5-deoxy-D-glucuronate isomerase (EC 5.3.1.30) (Pseudomonas fluorescens FW300-N2E3)
MSLLVKSSAKGRTLVEVPAGALEYVGFSAYRLSLGETLPVSAGDKELCLVLLSGRVDVSG
EAPGQGAFNWDNIGDRQSVFEDKSPFAAYLPPGSQAQVVALSDVQIAVCAAPGSASAGLA
PRLITPDSMKRSVRGKDANTRYVCDILPDTESAHSLLVVEVRTPSGHSSSYPPHKHDTDD
LPHQSFLEETYYHQVNPPQGFVFQRVYTDDRSIDQAMAVENSDLVVVPKGYHPVSVPYGY
ESYYLNVMAGPKRVWQFHNDPQHSWLLDL