Protein Info for AO353_21260 in Pseudomonas fluorescens FW300-N2E3

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 825 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 181 to 194 (14 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 288 to 315 (28 residues), see Phobius details amino acids 343 to 365 (23 residues), see Phobius details amino acids 393 to 410 (18 residues), see Phobius details amino acids 416 to 440 (25 residues), see Phobius details amino acids 464 to 484 (21 residues), see Phobius details amino acids 690 to 712 (23 residues), see Phobius details amino acids 743 to 763 (21 residues), see Phobius details amino acids 783 to 807 (25 residues), see Phobius details PF02687: FtsX" amino acids 248 to 370 (123 residues), 33.9 bits, see alignment E=2.9e-12 amino acids 698 to 814 (117 residues), 58.9 bits, see alignment E=5e-20 PF12704: MacB_PCD" amino acids 467 to 618 (152 residues), 28.1 bits, see alignment E=2.5e-10

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 80% identity to pba:PSEBR_a3744)

Predicted SEED Role

"AttF component of AttEFGH ABC transport system / AttG component of AttEFGH ABC transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VY02 at UniProt or InterPro

Protein Sequence (825 amino acids)

>AO353_21260 ABC transporter permease (Pseudomonas fluorescens FW300-N2E3)
MDVLRETLRALLSHWRQHPVQFFSVLTGLWLATGLLTGVQALNSQARESYARASQLIGGE
PQASLSAPNGATFSQALFVNLRRAGWPVSPVLQARLQLKGHEDLRLQLMGIEPLSLPSGS
ALAGQHLDMAQMVDFVGPPGRTWIAPSTLQALGLRDGDQPQNLNGQTLPPLHSQVDMAPG
VLLVDIGVAQQVLGLPAQLSRLLLPREFAATEPQLPSELTEQLQLKRSGEENNLARLTES
FHLNLDALGFLSFVVGLFIVHAAIGLALEQRRGLFRTLRACGVSVRTLIFCLSLELGGLA
LLGGMAGVVSGYLLASLLLPDVAASLRGLYGAEVAGRLSLSPLWWFSGLAVSLLGALLAG
ANSLLRAAQLPLLALANPQAWHQAHARWLRRQGWVAAVAAVIGLIALLWGDSLASGFVLM
AALLIGAALSLPVLLDVVLNRLVRRSRSVLGQWFLADCRQQLPALSLALMALLLALAANI
GAGSMTAGFRQTFSDWLEQRLTAELYVNPQNPAQATELQQWLPEQKINAVLPSWQVAVSL
QGWPADLFGVIDHPTYREHWPLLEALGERPWDQLVAHDTVMLSEQLARRLKLRLGDHLSI
PTPQGAWSPQLIGIYADYGNPKGHLLVNAEHLLHYWPQLTPSRFNLRIDPAQIPALLTAL
QSRFALDDSRIVDQARLKGWSTQVFERTFAATAALNSLTLGVAGVALFISLLTQSQSRLG
QLAPLWALGVTRRQLMLLNLGQTWLLALLTLVVALPLGLALAWCLDTVINVQAFGWRLPL
RVFPLQLVELMGLAMLATLLASAWPLFKLYRTQPADLLRSFAHED