Protein Info for AO353_21215 in Pseudomonas fluorescens FW300-N2E3

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 299 to 324 (26 residues), see Phobius details amino acids 328 to 350 (23 residues), see Phobius details amino acids 356 to 381 (26 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 46 to 265 (220 residues), 54.2 bits, see alignment E=2.9e-18 PF00535: Glycos_transf_2" amino acids 49 to 147 (99 residues), 50.5 bits, see alignment E=3.5e-17 PF13632: Glyco_trans_2_3" amino acids 129 to 327 (199 residues), 29.6 bits, see alignment E=9.7e-11

Best Hits

KEGG orthology group: None (inferred from 66% identity to ppw:PputW619_2905)

Predicted SEED Role

"Dolichol-phosphate mannosyltransferase (EC 2.4.1.83) in lipid-linked oligosaccharide synthesis cluster" (EC 2.4.1.83)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WFT8 at UniProt or InterPro

Protein Sequence (395 amino acids)

>AO353_21215 glycosyl transferase (Pseudomonas fluorescens FW300-N2E3)
MITLLDWLFSTLLVLIVLPVLVLFLQVLLACLPVRLRSSAQRSRLRVAVLVPAHNESSMI
VATLNSIRPQLLEGDRLLVVADNCSDDTAALARTAGAEVVERSNDQQCGKGYALDFGVRH
LASVAPDVVIIVDADCQVGEGSIERLAMCCIDSGRPTQALNLMLAPAGSGLKVRFAEFAW
RVKNLVRPQGWAWLGLPCQLMGTGMAFVWRDLALINLASGHIVEDLKMGFDFCRSGKPPL
FCPDALVTSYFPRSDEGLSIQRTRWEHGHLGVILGDAPKLFVESISRRNWNLLAMTLDLW
VPPLALLTIVLGAVFSLSWLVFMLFGALAPALIASVGVALLNVTILLAWSQCGREIISFS
ALLYAPFYVVKKIPLYLGFLLKRQVEWVRSKRDDN