Protein Info for AO353_21210 in Pseudomonas fluorescens FW300-N2E3

Annotation: glycoside hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 PF20706: GT4-conflict" amino acids 190 to 395 (206 residues), 27.7 bits, see alignment E=2.8e-10 PF13692: Glyco_trans_1_4" amino acids 222 to 362 (141 residues), 107.4 bits, see alignment E=1.5e-34 PF00534: Glycos_transf_1" amino acids 223 to 378 (156 residues), 120.4 bits, see alignment E=1.2e-38 PF13524: Glyco_trans_1_2" amino acids 308 to 392 (85 residues), 40.7 bits, see alignment E=4.5e-14

Best Hits

KEGG orthology group: None (inferred from 84% identity to pen:PSEEN2449)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VSB4 at UniProt or InterPro

Protein Sequence (400 amino acids)

>AO353_21210 glycoside hydrolase (Pseudomonas fluorescens FW300-N2E3)
MRIAYLINQYPKVSHSFIRREILALERQGFVVQRIALRGWDAELVDAEDVSERSKTSYVL
QGGVKELLVPVLKVLRAQPRRFFSALWLALRMGRHADRPWPYHLVYLSEACRLLFWLQAF
GAEHVHAHFGTNSTEVVMLANALGGPAYSFTVHGPEEFDKPQFIHLGEKVRRAAFVAAIS
SYGRSQLFRWVAHAHWARVKVVHCGLERAFHDVPAVAVPSVPRLVCVGRLCEQKGQLLLL
EAARILAAQAVVFEIVLAGDGEIRAQIEALIALHGLQAQVRITGWISSEQVRAEILAARA
LVLPSFAEGLPVVIMEAMALRRPVLTTYVAGIPELVRQGENGWLFPAGAVDELAAVLADC
LAQPVEVLQRMGEAAYQRVLERHDIDTEAAKLANLFRAQA