Protein Info for AO353_21165 in Pseudomonas fluorescens FW300-N2E3

Annotation: polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 266 to 292 (27 residues), see Phobius details amino acids 313 to 337 (25 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 381 to 398 (18 residues), see Phobius details amino acids 404 to 423 (20 residues), see Phobius details amino acids 435 to 455 (21 residues), see Phobius details PF01943: Polysacc_synt" amino acids 27 to 294 (268 residues), 54 bits, see alignment E=1.8e-18 PF13440: Polysacc_synt_3" amino acids 40 to 342 (303 residues), 131.3 bits, see alignment E=4.4e-42

Best Hits

KEGG orthology group: None (inferred from 68% identity to ppw:PputW619_2913)

Predicted SEED Role

"polysaccharide transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VXF5 at UniProt or InterPro

Protein Sequence (456 amino acids)

>AO353_21165 polysaccharide biosynthesis protein (Pseudomonas fluorescens FW300-N2E3)
MPSIELSSPQSLRKRVIWAGALNIGCMLASQVMRLGGNLVITRLLVPEMFGVMAIVTTVS
VLLLLLSDVGLRQNIIQSPRGDDPLFLNTMWTVQIVRGFVLFLLMQLLALCAWFAQHLQL
WPAHTTYAAAELPLALALTGFFAVIYGFQSTKVDVAIRTFQQKKVVLAELITQLAGLVVM
LVAGYFTRSIWSLVAASLLATLVYTVLSHLMFQGPNNRPQWDPAALREMLDYGRWILLSS
AVGVLAMQGDRIWFGGSMSAMELGVYSIAVSILGTIQLSLQRLAGAVALPALSEAARSGD
KERLRNLYYRFRLLFDLVSLFACGFLLTASPLIIGWLYDARYAGAGGIMAILSLSLFTLR
FTLAHQIWLALGLTKYLAMDNIIRVISLFILLPLLLAIGGVTYAIWGVALHTYLTLFLIY
KVSRQLGLFDLRRELAVLPALALGALFGALLVRLFA