Protein Info for AO353_21150 in Pseudomonas fluorescens FW300-N2E3

Annotation: polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details PF13440: Polysacc_synt_3" amino acids 40 to 179 (140 residues), 58.8 bits, see alignment E=2.7e-20

Best Hits

Predicted SEED Role

"polysaccharide transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>AO353_21150 polysaccharide biosynthesis protein (Pseudomonas fluorescens FW300-N2E3)
MPPIDLSPSLSLRRRAISAGAWNLGALVASQAIRLGGNLVMARLLMPKIFGVMIIATTVS
VVLHLLSDVGLRQNIIQSPRGDDPVFLNTAWTVQILRGVVLFASTLLIAGFTWFAQVINL
WSVNSTYAAPELPLVLVFTGFTAIIFGFQSTKLDLAVRDFQQKKVVLAEFASQLAGLLVI
AYLY