Protein Info for AO353_21125 in Pseudomonas fluorescens FW300-N2E3

Annotation: lipopolysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 419 to 438 (20 residues), see Phobius details amino acids 450 to 468 (19 residues), see Phobius details amino acids 482 to 501 (20 residues), see Phobius details PF02706: Wzz" amino acids 6 to 81 (76 residues), 26.2 bits, see alignment E=4.1e-10

Best Hits

KEGG orthology group: None (inferred from 69% identity to pen:PSEEN2947)

Predicted SEED Role

"exopolysaccharide transport protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WNC7 at UniProt or InterPro

Protein Sequence (516 amino acids)

>AO353_21125 lipopolysaccharide biosynthesis protein (Pseudomonas fluorescens FW300-N2E3)
MTSEYEMSVNDYIAVIKHHALLLILSFAVILGLSVVVAISIPPIYESSGTILVESQQISP
DLVAGNNNTFADERIEVIRQRVMTREHLEAIIDKYNLFASQSRQLSLSEKIDEMRNAITV
SLVSAVVKGRGEVTIAFRLAFEHRQPEIANKVANELVTLFLDENIKQRTERASETTEFLT
QEADKLRVELEALENRLADFKQAHSNALPEHQELRMNMLSRAETELKEVDRDYKTAREEL
RFNELELSAAATKHGSPGAAVDKQQDLGSLKAEYTRLLSLYTEAHPDVRAVKRKIAALEA
TKGAGGAAASVNLDLAKAQARITAAETRIKSLADQKQEILKKIADYEAQILETPQVERGL
VTLMRDYENAKKKYEEIRTKEMSAKISESLEQENKAERFVLLESPLMPEKPIRPNRKKVV
AMGFVLAPVGAGALVMVLEMLNQRVRGAEALASVLGRRILVAIPYIYTRAELARRKQWRT
RLIVSGVVIIVLFLVFLHFFYMPLDLLMFKTLGRFA