Protein Info for AO353_21070 in Pseudomonas fluorescens FW300-N2E3

Annotation: long-chain fatty acid--CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 31 to 405 (375 residues), 252.2 bits, E=7.7e-79
• PF13193: AMP-binding_C
  • amino acids 455 to 535 (81 residues), 65.8 bits, E=5.4e-22

Best Hits

KEGG orthology group: K00666, fatty-acyl-CoA synthase [EC: 6.2.1.-] (inferred from 73% identity to esc:Entcl_1369)

Predicted SEED Role

"Medium-chain-fatty-acid--CoA ligase (EC 6.2.1.-)" (EC 6.2.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis II
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Caprolactam degradation
• Ethylbenzene degradation
• Geraniol degradation
• Limonene and pinene degradation
• Propanoate metabolism
• Tyrosine metabolism
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.-

Sequence Analysis Tools

See A0A0N7H0L0 at UniProt or InterPro

Protein Sequence (547 amino acids)

>AO353_21070 long-chain fatty acid--CoA ligase (Pseudomonas fluorescens FW300-N2E3)
MMATKIIPPADGAYAYPLLIKQLLLSGVRYEPGREIVYADKLRYSYQTLNQRIRRLANAL
TAAGVKAGDTVALLDWDSHRYLECFFAVPMIGAVLHTVNIRLSADQVLFTMNHAEDDLVL
VHDDFLPLVEQIQGQLSTVKGYLQLTDDTATDTSLPVLGEYEQLLSQAADQYQFPDFDEN
SVATLFYTTGTTGDPKGVYFTHRQLVLHTLNAVGTLGVYQGLPLLRSDDVYMPITPMFHV
HAWGVPYVATLMGLKQVYPGRYEPNRLVRLYREESVTFSHCVPTLLQMILGCEEAAQTRF
DGWKMLLGGSALTLGIASEASARGIRVHSGYGMSETCPLLCTTYLRDEELQLPTQSQLAI
RIKTGTPVPMVDLKIVDANGNDMPHDGESVGEIVVRAPWLTQGYWKAPEKGAELWRDGWM
HTGDIASIDALGGVEIKDRIKDVIKTGGEWISSLELESLISEHSAVMSVAVVGIADEQWG
ERPMALVVCAPGQYLDRKILEVHLQGFVERGRINKWAIPKQFKFVTEIPKTSVGKINKKL
IRESELS