Protein Info for AO353_21030 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 16 to 33 (18 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 286 to 303 (18 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 18 to 316 (299 residues), 238.8 bits, see alignment E=3.4e-75

Best Hits

Swiss-Prot: 57% identical to TAUZ_PARDE: UPF0324 membrane protein TauZ (tauZ) from Paracoccus denitrificans

KEGG orthology group: None (inferred from 79% identity to acd:AOLE_06120)

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0K9 at UniProt or InterPro

Protein Sequence (336 amino acids)

>AO353_21030 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MSVIALTHIHSRTRELAPGFVVSLIVAAAASFLSEHYGAPVMLFALLLGMALNFLASDGA
CKAGIEFTARTVLRIGVALLGMRITLEQIAALGWKPFALVVILVVVTISVSVVAAKALGF
QRLFGMLTGGATAICGASAAMALAAALPNHPQKERATLFTVIGVSALSTTAMILYPMIAN
WLSLSPQVAGMFLGGTIHDVAQVVGAGYSLSTETGDIATVVKLMRVAMLLPVILCATLIT
RMQGADTSGKRPPLLPWFAVGFLLLACINSTGWVAPAVQGSVNELSRWSLVVSISALGMK
TQLKELAAVGIKPILLMVGETVFLAVLVLLLLHWGL