Protein Info for AO353_21015 in Pseudomonas fluorescens FW300-N2E3

Annotation: multidrug DMT transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 117 to 142 (26 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details amino acids 395 to 414 (20 residues), see Phobius details PF07690: MFS_1" amino acids 33 to 381 (349 residues), 155.7 bits, see alignment E=1.6e-49

Best Hits

KEGG orthology group: None (inferred from 78% identity to ppg:PputGB1_2817)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X2Z2 at UniProt or InterPro

Protein Sequence (443 amino acids)

>AO353_21015 multidrug DMT transporter permease (Pseudomonas fluorescens FW300-N2E3)
MAFHPIAADDDDASGVGIARQYAWIVFALTFGLLISDYMSRQVLNAVFPMLKGEWALSDG
QLGLLSGIVALMVGLLTFPLSLLADRFGRVKSLALMALLWSLATLGCALAQDYQQMFIAR
FMVGVGEAAYGSVGIAVVISVFPKHMRATLASAFMAGGMFGSVLGMALGGVLAAKLGWRW
SFAGMALFGLLLAVLYPIIVKEARIAPQRAAQAANKVAAAVKRPLSTLCSSPSVIAAYIG
SGLQLFVGGTVIVWMPSYLNRYYDMATDKAGGVAAIIVLCSGAGMILCGMLSDRLCRHSP
ERKVALAIAYCLGSCLLLSAAFALPAGPAQLALICLGMLIAAGTTGPAGAMVANLTHHSV
HGTAFATLTLANNMLGLAPGPFITGRVSDVIGLQAAFQWVPLVSIAAAAVFFYAKCHYHK
DIARLAGERVNDSISEAVSEVKV