Protein Info for AO353_20835 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): Ribokinase (EC 2.7.1.15)
Rationale: Specifically important for utilizing D-Ribose. Automated validation from mutant phenotype: the predicted function (RIBOKIN-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: ribokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF00294: PfkB" amino acids 3 to 295 (293 residues), 237.2 bits, see alignment E=2.7e-74 TIGR02152: ribokinase" amino acids 5 to 300 (296 residues), 371.4 bits, see alignment E=1.7e-115 PF08543: Phos_pyr_kin" amino acids 180 to 277 (98 residues), 37.9 bits, see alignment E=1.4e-13

Best Hits

Swiss-Prot: 42% identical to RBSK_ECOLI: Ribokinase (rbsK) from Escherichia coli (strain K12)

KEGG orthology group: K00852, ribokinase [EC: 2.7.1.15] (inferred from 86% identity to pfl:PFL_2105)

MetaCyc: 42% identical to ribokinase (Escherichia coli K-12 substr. MG1655)
Ribokinase. [EC: 2.7.1.15]

Predicted SEED Role

"Ribokinase (EC 2.7.1.15)" in subsystem D-ribose utilization or Deoxyribose and Deoxynucleoside Catabolism (EC 2.7.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WYV5 at UniProt or InterPro

Protein Sequence (305 amino acids)

>AO353_20835 Ribokinase (EC 2.7.1.15) (Pseudomonas fluorescens FW300-N2E3)
MPAKVVVVGSLNMDLVTRAQRLPHAGETLHGESFATVSGGKGANQAVASARLGAQVSMIG
CVGDDAYGEQLRAALLAEQIDCQALTSVEGSSGVALIVVDDNSQNAIVIVAGANGQLTPG
MVAGFDAVLAAADVIICQLEVPMHTVGYVLKRGRELGKTVILNPAPATSPLPADWYSSID
YLIPNESEASALSGLPVDSLESAELAASRLIAAGAGKVIITLGPQGSLFANGQSCEHFPA
PKVKSVDTTAAGDTFVGGFAAALAAGKSEVEAIRFGQVAAALSVTRAGAQPSIPSLSDVQ
AFKAS