Protein Info for AO353_20830 in Pseudomonas fluorescens FW300-N2E3

Annotation: LacI family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF00356: LacI" amino acids 3 to 48 (46 residues), 60.9 bits, see alignment 1.6e-20 PF00532: Peripla_BP_1" amino acids 60 to 306 (247 residues), 133.5 bits, see alignment E=2.1e-42 PF13407: Peripla_BP_4" amino acids 62 to 304 (243 residues), 62.9 bits, see alignment E=7.2e-21 PF13377: Peripla_BP_3" amino acids 169 to 328 (160 residues), 128.4 bits, see alignment E=6e-41

Best Hits

Swiss-Prot: 46% identical to PURR_PHOPR: HTH-type transcriptional repressor PurR (purR) from Photobacterium profundum (strain SS9)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 93% identity to pfo:Pfl01_1922)

Predicted SEED Role

"Ribose operon repressor" in subsystem D-ribose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WL81 at UniProt or InterPro

Protein Sequence (339 amino acids)

>AO353_20830 LacI family transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MATIKDVAALAGISYTTVSHVVNKTRPVSEEVRLKVEAAIKSLDYVPSAVARSLKAKTTA
TIGLLVPNSLNPYFAELARGIEDYCERNGYCVILCNSDDNPDKQRSYLRVLLEKRIDGLI
VASAGGDSGLAQGLAGVRTPMVIVDRGLEGLDADMVRIDHEYGAYLATRHLLELGHRDIA
TIGGPAHTSVAQMRLAGYCRALKEAGVEVPGEWMLESDFTSIGGYNAATMLLEKHPPSAI
FAGNDMIGIGVLRAAAERNIRVPSELSVIGFDDIQMSRYVYPALTTVGQSILQLGEMAAE
VLLRRIATPELATDQRIVRPSIVMRESTAPLAGVFDQYR