Protein Info for AO353_20815 in Pseudomonas fluorescens FW300-N2E3

Annotation: LacI family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 34 to 296 (263 residues), 83.7 bits, see alignment E=2.4e-27 PF13407: Peripla_BP_4" amino acids 36 to 299 (264 residues), 197.2 bits, see alignment E=5.8e-62 PF13377: Peripla_BP_3" amino acids 169 to 302 (134 residues), 37.6 bits, see alignment E=3.8e-13

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 94% identity to pba:PSEBR_a3711)

Predicted SEED Role

"Ribose ABC transport system, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VXC7 at UniProt or InterPro

Protein Sequence (317 amino acids)

>AO353_20815 LacI family transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MKLPFAGRLLAVAMLAAASAALPLSSAFADTEKPKVALVMKSLANEFFLTMEDGAKAYQK
EHSADFDLISNGIKDETDTAGQTRIVEQMILAKVNALVIAPADSKAMVPVIKKAIDAGIT
VINIDNQLDPAVVKSKNMTVPFVGPDNRKGARLVGEYLAKQLKAGDEVGIIEGVSTTTNA
QARTAGFKDAMEAAQIKVVSLQSGDWEIDKGNKVAASILSEYPQTKALLAGNDSMAVGAV
SAVRAAGKAGKVQVVGYDNINAIKPMLKDGRVLATADQFAAKQAVFGIETALKMLKGEKV
DSGTNGVIETPVELVTK